Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P12_F_N11
         (589 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   1.9  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    22   4.4  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = +3

Query: 288  AIGLGGGVLW 317
            A+GLGGG++W
Sbjct: 2154 AMGLGGGMIW 2163


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 21.8 bits (44), Expect = 4.4
 Identities = 16/64 (25%), Positives = 26/64 (40%)
 Frame = +2

Query: 260 SPSRTTIDRSYRSRRGSTVASSCHGYLSADLRARIR*CVRAPIRSQRAAALSQVTPGCCA 439
           SP+ T     Y S+ GS        Y +     ++  C R  +++ RA+      P   +
Sbjct: 219 SPTFTQQQTQY-SQYGSWFLPHQPIYPAVTATVQLSTCTRTTLKNNRASPYPMQRPKSAS 277

Query: 440 GSPP 451
            SPP
Sbjct: 278 LSPP 281


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,217
Number of Sequences: 336
Number of extensions: 2079
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14726181
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)