BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P11_pT_N11
(616 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014296-2250|AAF49838.2| 714|Drosophila melanogaster CG11281-P... 32 0.71
>AE014296-2250|AAF49838.2| 714|Drosophila melanogaster CG11281-PA
protein.
Length = 714
Score = 31.9 bits (69), Expect = 0.71
Identities = 14/50 (28%), Positives = 30/50 (60%)
Frame = +3
Query: 165 FQ*IVMYLYIIIMNHIITTHKYLNTRYFVYFFFTKANQQGAFLYNQLQKS 314
+Q I++YL II++ + TT + +F++ + Q+ FLYN++ ++
Sbjct: 553 YQLILLYLIIIVLIYQSTTFLRMRRVICSFFYYKREKQRILFLYNRILRN 602
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,351,134
Number of Sequences: 53049
Number of extensions: 283615
Number of successful extensions: 787
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 778
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 787
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2517878700
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -