BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P11_pT_G06
(754 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase pr... 25 2.5
>Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase
protein.
Length = 237
Score = 25.0 bits (52), Expect = 2.5
Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
Frame = -2
Query: 348 LATAQKSSNVSKTTIL*ENKANLWRLXQGLKQHKN*PVSAMHCEGTASHKNR-TDSL 181
L A +S T++ KA+ W L QGL++ +S M C ++ +R TD++
Sbjct: 106 LPVAGRSFAGQNGTVIGWGKASEWSLSQGLQKAIVPIISNMQCRKSSYRASRITDNM 162
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 718,162
Number of Sequences: 2352
Number of extensions: 14424
Number of successful extensions: 41
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 41
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 77755161
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -