SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P11_pT_D01
         (309 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ437578-1|ABD96048.1|  234|Anopheles gambiae short neuropeptide...    24   1.5  
AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.    22   4.5  
AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         21   7.9  

>DQ437578-1|ABD96048.1|  234|Anopheles gambiae short neuropeptide F
           prepropeptide protein.
          Length = 234

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 11/32 (34%), Positives = 15/32 (46%)
 Frame = -3

Query: 172 PGWGLYHIHNLTLGNHYRRSLTDRWSRALYQR 77
           P W +Y+ H LT G   + +      RA  QR
Sbjct: 170 PSWAMYNEHQLTTGQQAQPANEASEKRAPTQR 201


>AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.
          Length = 1133

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 273 SERKHLCNLGYE 238
           SERK +C  GYE
Sbjct: 30  SERKDVCKTGYE 41


>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -2

Query: 290  DGHCYFPNENTC 255
            DG CY P++  C
Sbjct: 1444 DGFCYSPSDRQC 1455


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 317,289
Number of Sequences: 2352
Number of extensions: 5209
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 56
effective length of database: 432,267
effective search space used: 19884282
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -