BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P11_pT_C09
(712 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC084197-48|AAY43983.1| 250|Caenorhabditis elegans Hypothetical... 30 1.9
>AC084197-48|AAY43983.1| 250|Caenorhabditis elegans Hypothetical
protein Y73B6BL.44 protein.
Length = 250
Score = 29.9 bits (64), Expect = 1.9
Identities = 16/47 (34%), Positives = 26/47 (55%)
Frame = +3
Query: 93 IFRHXRKVTLHLSIVNSMPQKYVVFL*NSKIET*NLNSKIESDKELW 233
I R RK S+V ++P+KY + S I N+N K++ +K+ W
Sbjct: 104 ILRKSRKECKVPSVVQALPEKYQKKI--SDIWEKNINEKVKKEKDCW 148
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,211,683
Number of Sequences: 27780
Number of extensions: 232027
Number of successful extensions: 353
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 348
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 353
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1655655746
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -