SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P11_F_J23
         (651 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    24   1.5  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    24   1.5  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    24   1.5  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    22   4.5  
DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    21   7.8  
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    21   7.8  
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    21   7.8  
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    21   7.8  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    21   7.8  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    21   7.8  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    21   7.8  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    21   7.8  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    21   7.8  

>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = -2

Query: 329 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 237
           LSIS L  L +FFL+ +   P   ++   +G
Sbjct: 278 LSISILISLHVFFLLVVEIIPPTSLVVPLLG 308


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = -2

Query: 329 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 237
           LSIS L  L +FFL+ +   P   ++   +G
Sbjct: 278 LSISILISLHVFFLLVVEIIPPTSLVVPLLG 308


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = -2

Query: 329 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 237
           LSIS L  L +FFL+     P   ++   +G
Sbjct: 274 LSISILLSLTVFFLLLAEIIPPTSLVVPLLG 304


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = -2

Query: 329 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 237
           LSIS L  L +FFL+     P   +    +G
Sbjct: 270 LSISILLSLTVFFLLLAEIIPPTSLTVPLLG 300


>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 114 PVPFPVYY 121


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 114 PVPFPVYY 121


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 114 PVPFPVYY 121


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 114 PVPFPVYY 121


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 347 PVPFPVYY 354


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 347 PVPFPVYY 354


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 347 PVPFPVYY 354


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 347 PVPFPVYY 354


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 441 PEPFPVYY 464
           P PFPVYY
Sbjct: 336 PVPFPVYY 343


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,163
Number of Sequences: 438
Number of extensions: 4193
Number of successful extensions: 15
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19682733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -