BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P11_F_A19
(686 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 6.8
>M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein.
Length = 613
Score = 23.4 bits (48), Expect = 6.8
Identities = 17/64 (26%), Positives = 32/64 (50%)
Frame = +1
Query: 343 QPKRKEEDEYQYTACKAFKQLLQELGDFAGQREVVAENLQSNVVRELHLLAKELREERKQ 522
QP+++++ +Y + +QL Q+ QR VVA + Q ++ H ++ R+ K
Sbjct: 328 QPQQQQQQTGRYQPPQMRQQLQQQQQQRQPQRYVVAGSSQQQ--QQQHQQQQQKRKRPKP 385
Query: 523 HLNE 534
L E
Sbjct: 386 ELIE 389
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 707,303
Number of Sequences: 2352
Number of extensions: 15363
Number of successful extensions: 35
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 69413730
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -