SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P10_pT_C20
         (784 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_03_0050 + 11959421-11959736,11959892-11959960,11960641-119609...    32   0.45 

>01_03_0050 +
           11959421-11959736,11959892-11959960,11960641-11960979,
           11961090-11961152,11962472-11962962,11963773-11964441
          Length = 648

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 292 ISLIKHTHVKISTKHLI*LKYTY*YENICYFYSSKNLRLRIYFENIIPPNNAI 450
           +SL+ H H+K+S K L   K ++ Y+   Y  S K   L I  +    P +A+
Sbjct: 323 VSLVDHAHIKVSEKRLRTQKRSFSYKKDRYSKSKKKKNLNILSKEEDKPAHAV 375


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,446,705
Number of Sequences: 37544
Number of extensions: 212464
Number of successful extensions: 230
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 228
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 230
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2103658836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -