SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P10_F_M18
         (855 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY705405-1|AAU12514.1|  519|Anopheles gambiae nicotinic acetylch...    25   2.2  
AF080565-1|AAC31945.1|  324|Anopheles gambiae Antennapedia homeo...    25   2.2  
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    23   9.0  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    23   9.0  

>AY705405-1|AAU12514.1|  519|Anopheles gambiae nicotinic
           acetylcholine receptor subunitbeta 1 protein.
          Length = 519

 Score = 25.4 bits (53), Expect = 2.2
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +1

Query: 247 NLWQKIFLKCTLFLFVTQKISEINSIQKGHLWLR 348
           N+ QK+ ++  L       ++E N I K ++WLR
Sbjct: 47  NMTQKVDVRFGLAFVQLINVNEKNQIMKSNVWLR 80


>AF080565-1|AAC31945.1|  324|Anopheles gambiae Antennapedia homeotic
           protein protein.
          Length = 324

 Score = 25.4 bits (53), Expect = 2.2
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +1

Query: 535 QECYHTQIHDSPLH 576
           QECY  Q+H +P H
Sbjct: 171 QECYPEQVHQTPQH 184


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 9/11 (81%), Positives = 9/11 (81%)
 Frame = -2

Query: 152  LLKNTPQNCCS 120
            LLK T QNCCS
Sbjct: 1427 LLKKTCQNCCS 1437


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1978

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 9/11 (81%), Positives = 9/11 (81%)
 Frame = -2

Query: 152  LLKNTPQNCCS 120
            LLK T QNCCS
Sbjct: 1424 LLKKTCQNCCS 1434


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 906,495
Number of Sequences: 2352
Number of extensions: 19930
Number of successful extensions: 25
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 90959220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -