Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P10_F_J17
         (772 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC025721-7|AAK29911.3|  668|Caenorhabditis elegans Half transpor...    28   6.4  

>AC025721-7|AAK29911.3|  668|Caenorhabditis elegans Half transporter
           (pgp related)protein 6 protein.
          Length = 668

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 3/69 (4%)
 Frame = -3

Query: 620 VGARTNCPYKSAQYSGSLCAAVNLIKYEQTVQSIVSHFQKS---NMYLTT*LFSIILAG* 450
           + AR N   +  + S  LC +  L  + QT+  I S +  S    MY    +  IILAG 
Sbjct: 204 LSARLNADVQEFKSSFKLCVSQGLRTFAQTIGCIGSLYFLSPTMTMYTVAVVPGIILAGS 263

Query: 449 SINQDIAQL 423
           +I   + QL
Sbjct: 264 AIGAGLRQL 272


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,633,019
Number of Sequences: 27780
Number of extensions: 334858
Number of successful extensions: 804
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 787
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 804
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1851132448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)