BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P10_F_J16
(935 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 3.3
>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
channel alpha1 subunit protein.
Length = 1893
Score = 25.0 bits (52), Expect = 3.3
Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 2/63 (3%)
Frame = +2
Query: 545 YFVFKQ*FRFYIYFLLLV*RTKT*VMNVGLG--VPNSVLSAPNLVLTEKNSKEFIVNLSS 718
+FV Q F + I+ L+++ T T M + VL NL+ T + EF+ L++
Sbjct: 1170 WFVTSQPFEYMIFVLIMI-NTITLSMKFYRQPEIYTEVLDLLNLIFTAVFALEFVFKLAA 1228
Query: 719 FSY 727
F +
Sbjct: 1229 FRF 1231
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 935,606
Number of Sequences: 2352
Number of extensions: 17825
Number of successful extensions: 61
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 102122397
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -