SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P10_F_J10
         (766 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0529 - 19107949-19108152,19108857-19109147,19109817-191099...    28   7.1  

>07_03_0529 -
           19107949-19108152,19108857-19109147,19109817-19109939,
           19110019-19110306
          Length = 301

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 15/54 (27%), Positives = 28/54 (51%)
 Frame = +1

Query: 427 IRSGVTVT*AHHSLIENNFSQTKQRLFLTILLGFYFTILQAYEYIEASFTIADR 588
           + + V +  +HH  ++    Q   +  L I+   +F++LQ Y Y  A ++ ADR
Sbjct: 240 VLAAVGIIQSHHFWLDVEHIQEAIQNVLVIIEMVFFSVLQQYAYHVAPYSGADR 293


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,086,655
Number of Sequences: 37544
Number of extensions: 193556
Number of successful extensions: 324
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 320
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 324
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2051430072
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -