SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P10_F_F15
         (369 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    22   1.7  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      20   9.2  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      20   9.2  

>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 22.2 bits (45), Expect = 1.7
 Identities = 11/35 (31%), Positives = 15/35 (42%)
 Frame = +2

Query: 26  CKLRFQHVLQIVHPLCSVGGRGFRQPQPQA*ASAD 130
           C+ RF+    +VH  C       R P P   A+ D
Sbjct: 252 CRGRFRRRHHLVHHKCGGEEEAERAPAPAVRAAGD 286


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 19.8 bits (39), Expect = 9.2
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 83  GRGFRQPQPQA 115
           G GFR P P A
Sbjct: 199 GAGFRSPYPSA 209


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 19.8 bits (39), Expect = 9.2
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 83  GRGFRQPQPQA 115
           G GFR P P A
Sbjct: 91  GAGFRSPYPSA 101


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,927
Number of Sequences: 336
Number of extensions: 563
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  7616520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -