Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P09_pT_C09
         (842 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6L140 Cluster: Glycosyltransferase family 4; n=1; Bact...    36   1.3  

>UniRef50_A6L140 Cluster: Glycosyltransferase family 4; n=1;
           Bacteroides vulgatus ATCC 8482|Rep: Glycosyltransferase
           family 4 - Bacteroides vulgatus (strain ATCC 8482 / DSM
           1447 / NCTC 11154)
          Length = 372

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 18/39 (46%), Positives = 22/39 (56%)
 Frame = +3

Query: 711 KFVKFNACSRVLCSGVRIPFXCYKYKYS*KHTLFYFYAI 827
           KF +F  C R L     IPF CYKYK +  H+L Y + I
Sbjct: 61  KFFRFFFC-RFLLEQFYIPFLCYKYKINILHSLHYSFPI 98


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 767,336,153
Number of Sequences: 1657284
Number of extensions: 14865876
Number of successful extensions: 24779
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 24105
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24779
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 73783549980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)