SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P09_F_L16
         (534 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37662| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   3e-08

>SB_37662| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 433

 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 24/37 (64%), Positives = 27/37 (72%)
 Frame = +1

Query: 211 DVDAICTCKILQGLFKSDNISYTLVPVGGISELKTAY 321
           DVDA+C CKIL+ LFK DNI YTLVP  G  +L  AY
Sbjct: 2   DVDALCACKILKWLFKCDNIQYTLVPASGKEDLARAY 38


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,339,107
Number of Sequences: 59808
Number of extensions: 283282
Number of successful extensions: 694
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 551
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 630
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1203486867
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -