SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P09_F_J22
         (810 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     24   1.2  
EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2 p...    22   6.6  

>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 11/40 (27%), Positives = 17/40 (42%)
 Frame = +1

Query: 514 GDHPGHNPERDAYEALAACPHMRGVIPRYYRELEYDGERF 633
           G H  ++P  D    +  CP   G+  RY+  +   G  F
Sbjct: 137 GHHQKNSPYMDGVPFVTQCPIHPGMTFRYHFNVHNSGTHF 176


>EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2
           protein.
          Length = 535

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +3

Query: 504 SCCGRPPRPQP 536
           +C G PP+P+P
Sbjct: 172 ACMGPPPQPEP 182


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,229
Number of Sequences: 336
Number of extensions: 3562
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22102797
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -