SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P09_F_F14
         (809 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        23   3.8  
AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix...    22   6.6  

>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 13/52 (25%), Positives = 26/52 (50%)
 Frame = +3

Query: 579 SAAIIPNMVKKIDLAPNVXSDAAAVPEIKTPEAADAPKLADNPVXEDKPADI 734
           S +++ +M+  ++  P+  +D + V   +TP    +    DN   E KP D+
Sbjct: 445 STSVVGDMLN-MNWNPSAQNDLSGVNLSETPSGISSLLNLDNQQLELKPIDL 495


>AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix
           transcription factor protein.
          Length = 249

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 103 MDPVTRRRFLKH 68
           +DPV +RR L+H
Sbjct: 127 LDPVVKRRLLQH 138


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,898
Number of Sequences: 336
Number of extensions: 2106
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22102797
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -