BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P09_F_F14
(809 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 3.8
AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 6.6
>AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein.
Length = 556
Score = 22.6 bits (46), Expect = 3.8
Identities = 13/52 (25%), Positives = 26/52 (50%)
Frame = +3
Query: 579 SAAIIPNMVKKIDLAPNVXSDAAAVPEIKTPEAADAPKLADNPVXEDKPADI 734
S +++ +M+ ++ P+ +D + V +TP + DN E KP D+
Sbjct: 445 STSVVGDMLN-MNWNPSAQNDLSGVNLSETPSGISSLLNLDNQQLELKPIDL 495
>AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix
transcription factor protein.
Length = 249
Score = 21.8 bits (44), Expect = 6.6
Identities = 7/12 (58%), Positives = 10/12 (83%)
Frame = -2
Query: 103 MDPVTRRRFLKH 68
+DPV +RR L+H
Sbjct: 127 LDPVVKRRLLQH 138
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,898
Number of Sequences: 336
Number of extensions: 2106
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22102797
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -