Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P09_F_B01
         (863 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    28   0.11 
EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B pro...    21   9.4  

>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 27.9 bits (59), Expect = 0.11
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +3

Query: 12  WFICTLAFRRAAVSVQYFVFKNLSFSSFELHLMHFFNHFVFSRAQC*VNS 161
           +FIC L FR    ++ +++    + S+FE+   +++N   FSR    +NS
Sbjct: 301 FFICLLPFR----ALTFWIIVAPAGSNFEIGFENYYNILYFSRIMFHINS 346


>EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B
           protein.
          Length = 279

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = +3

Query: 510 CKAGELFDELG 542
           CK G++FD++G
Sbjct: 209 CKLGQVFDDVG 219


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,395
Number of Sequences: 336
Number of extensions: 3195
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 23789590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)