BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P08_pT_L09
(508 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 24 0.79
Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 7.3
AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 9.7
>DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain
protein protein.
Length = 448
Score = 24.2 bits (50), Expect = 0.79
Identities = 14/52 (26%), Positives = 25/52 (48%)
Frame = -2
Query: 315 RAVTGVLRGFDPFMNLVLDESVEECKDGQRNNVGMVVIRGNSIIMLESLDRL 160
R V + GFDP++ DE +E+ D + + + G +I L L ++
Sbjct: 225 RMVDENINGFDPYVKTPNDEELEKPTDKRMFVLAASIKAGYTIDRLYELTKI 276
>Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein
RJP57-2 protein.
Length = 464
Score = 21.0 bits (42), Expect = 7.3
Identities = 6/11 (54%), Positives = 10/11 (90%)
Frame = -1
Query: 139 RNITNAVNVLH 107
+N+TN +NV+H
Sbjct: 30 KNLTNTLNVIH 40
>AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A
isoform protein.
Length = 567
Score = 20.6 bits (41), Expect = 9.7
Identities = 6/10 (60%), Positives = 9/10 (90%)
Frame = -1
Query: 457 HLIYKNPRQQ 428
H++Y NP+QQ
Sbjct: 107 HVVYGNPQQQ 116
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,795
Number of Sequences: 438
Number of extensions: 2543
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 13986774
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -