SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P08_pT_L09
         (508 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase doma...    24   0.79 
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    21   7.3  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    21   9.7  

>DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase domain
           protein protein.
          Length = 448

 Score = 24.2 bits (50), Expect = 0.79
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = -2

Query: 315 RAVTGVLRGFDPFMNLVLDESVEECKDGQRNNVGMVVIRGNSIIMLESLDRL 160
           R V   + GFDP++    DE +E+  D +   +   +  G +I  L  L ++
Sbjct: 225 RMVDENINGFDPYVKTPNDEELEKPTDKRMFVLAASIKAGYTIDRLYELTKI 276


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 21.0 bits (42), Expect = 7.3
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -1

Query: 139 RNITNAVNVLH 107
           +N+TN +NV+H
Sbjct: 30  KNLTNTLNVIH 40


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 20.6 bits (41), Expect = 9.7
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -1

Query: 457 HLIYKNPRQQ 428
           H++Y NP+QQ
Sbjct: 107 HVVYGNPQQQ 116


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,795
Number of Sequences: 438
Number of extensions: 2543
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 13986774
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -