Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P08_pT_J20
         (333 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    21   3.0  
DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          21   5.2  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   5.2  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    20   6.8  

>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 21.4 bits (43), Expect = 3.0
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -3

Query: 298 YPLSTCIFYMDT 263
           YPL+ C++Y  T
Sbjct: 298 YPLTGCLYYFST 309


>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 20.6 bits (41), Expect = 5.2
 Identities = 11/43 (25%), Positives = 19/43 (44%)
 Frame = -2

Query: 326 SPXTHINISLSIKYMYFLHGYQVSSQSDARFSSYNGTTVKTTV 198
           S  T  ++      +YFL  Y +   + A  ++   TT  TT+
Sbjct: 356 SEQTIFDVKPEFGSIYFLGNYSLVPTTTASPTTEPSTTTSTTI 398


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 20.6 bits (41), Expect = 5.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 149  QQTFYQDIHNLY 184
            Q   Y D+HNLY
Sbjct: 1466 QLNHYPDLHNLY 1477


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 20.2 bits (40), Expect = 6.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 236 TLHPIDLKLGIH 271
           T  P+D+++GIH
Sbjct: 359 TNSPVDMRVGIH 370


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,132
Number of Sequences: 438
Number of extensions: 1220
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7466580
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)