SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P08_pT_J05
         (674 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    28   1.4  

>SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 977

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -1

Query: 419 TLSVVKNIEHTNNSQT*SVSIAISTLCNVYIFFIYLKTNN-NIALLFT 279
           T S VKN+    N  T    + +  L N+Y++ I  K +  +++LLFT
Sbjct: 294 TQSDVKNLHFGKNKHTKPHLLVMDALSNLYVWKILQKRSEISVSLLFT 341


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,386,023
Number of Sequences: 5004
Number of extensions: 44584
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 53
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 309878492
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -