SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P08_pT_H03
         (494 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    22   3.1  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    21   9.5  

>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
            protein.
          Length = 1010

 Score = 22.2 bits (45), Expect = 3.1
 Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 7/65 (10%)
 Frame = +1

Query: 265  GGMGLAQRLRDHSLAGGSGVRGMSEHWSAISCVSSGIT-------SVGDNGSGAIGSVGD 423
            G  G+   L+      G GV+GM+  +      S G T        V   GSG + S   
Sbjct: 870  GVQGVPGLLQGVQQVFGQGVQGMNVPYGMQRGQSGGQTWSNSQVQGVAVPGSGIVASGQQ 929

Query: 424  HGGGY 438
            H GG+
Sbjct: 930  HAGGW 934


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +1

Query: 40  ICLYIFKLFTI 72
           +CL IF LFTI
Sbjct: 529 MCLIIFTLFTI 539


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,035
Number of Sequences: 438
Number of extensions: 1261
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13667319
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -