BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P08_pT_D20
(391 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AL161651-9|CAI14224.1| 132|Homo sapiens mitogen-activated prote... 29 7.1
>AL161651-9|CAI14224.1| 132|Homo sapiens mitogen-activated protein
kinase kinase kinase 8 protein.
Length = 132
Score = 28.7 bits (61), Expect = 7.1
Identities = 10/34 (29%), Positives = 16/34 (47%)
Frame = -1
Query: 286 KHFFMYKQS*KGVKCNNFNYYIKRWALCLQIEQC 185
KHF+ + G+ N ++ W LC Q+ C
Sbjct: 96 KHFYGQRPQESGILLNMVRFFPISWVLCAQLSYC 129
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,548,241
Number of Sequences: 237096
Number of extensions: 730515
Number of successful extensions: 910
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 907
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 910
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2698607930
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -