BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P08_F_M07
(835 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 22 6.1
AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 6.1
DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 8.0
>AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein
75 protein.
Length = 87
Score = 22.2 bits (45), Expect = 6.1
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -1
Query: 337 LNKNRCLYCHV 305
+N+NRC YC +
Sbjct: 66 INRNRCQYCRL 76
>AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein
75 protein.
Length = 900
Score = 22.2 bits (45), Expect = 6.1
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -1
Query: 337 LNKNRCLYCHV 305
+N+NRC YC +
Sbjct: 115 INRNRCQYCRL 125
>DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel
protein.
Length = 463
Score = 21.8 bits (44), Expect = 8.0
Identities = 10/31 (32%), Positives = 15/31 (48%)
Frame = -2
Query: 726 PYKLSNLLFVTESLTLIAGTFKSPSRNILYK 634
P L N T+ L G+F R+++YK
Sbjct: 131 PMNLENFPMDTQRCPLQFGSFGYTKRDVIYK 161
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 235,015
Number of Sequences: 438
Number of extensions: 5130
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26702940
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -