Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P08_F_G11
         (528 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript...    25   1.6  
U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette...    23   8.4  
U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette...    23   8.4  
U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette...    23   8.4  

>AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1209

 Score = 25.0 bits (52), Expect = 1.6
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +1

Query: 97  NAKKAKKPVLIAKSNIILDVKPWDDETDMAALEQAVRSIST 219
           N  KA     +A       V  W + TD+ ALE+ +R +ST
Sbjct: 823 NKVKAINTFAVALLTYSFGVMKWSN-TDLEALERTIRVVST 862


>U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 354 LCTKCRYCCVQQ 389
           LCT+ R CC +Q
Sbjct: 94  LCTRLRNCCTRQ 105


>U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 354 LCTKCRYCCVQQ 389
           LCT+ R CC +Q
Sbjct: 94  LCTRLRNCCTRQ 105


>U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 673

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 354 LCTKCRYCCVQQ 389
           LCT+ R CC +Q
Sbjct: 72  LCTRLRSCCTRQ 83


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.315    0.133    0.384 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 384,520
Number of Sequences: 2352
Number of extensions: 7431
Number of successful extensions: 39
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 39
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 48628785
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)