SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P07_pT_J07
         (517 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodops...    22   3.3  
AY703752-1|AAU12748.1|  152|Apis mellifera long-wavelength rhodo...    22   3.3  
AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength rhodo...    22   3.3  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    21   10.0 

>U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodopsin
           protein.
          Length = 377

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 319 MLGSCFGCG 345
           MLGS FGCG
Sbjct: 130 MLGSLFGCG 138


>AY703752-1|AAU12748.1|  152|Apis mellifera long-wavelength
           rhodopsin protein.
          Length = 152

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 319 MLGSCFGCG 345
           MLGS FGCG
Sbjct: 96  MLGSLFGCG 104


>AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength
           rhodopsin protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 319 MLGSCFGCG 345
           MLGS FGCG
Sbjct: 6   MLGSLFGCG 14


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 20.6 bits (41), Expect = 10.0
 Identities = 9/40 (22%), Positives = 15/40 (37%)
 Frame = -3

Query: 158 KVAFVTLPKTMTFKYPDLFEKSINEEEXHAKSLDESKKNF 39
           K+    LPK +  + PD     +   + H +     K  F
Sbjct: 338 KIFIRRLPKLLLMRVPDDLLNDLAAHKMHGRGRSGKKSKF 377


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,812
Number of Sequences: 438
Number of extensions: 2365
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14354847
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -