BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P07_pT_J07
(517 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 3.3
AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 3.3
AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 22 3.3
AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 10.0
>U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin
protein.
Length = 377
Score = 22.2 bits (45), Expect = 3.3
Identities = 8/9 (88%), Positives = 8/9 (88%)
Frame = +1
Query: 319 MLGSCFGCG 345
MLGS FGCG
Sbjct: 130 MLGSLFGCG 138
>AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength
rhodopsin protein.
Length = 152
Score = 22.2 bits (45), Expect = 3.3
Identities = 8/9 (88%), Positives = 8/9 (88%)
Frame = +1
Query: 319 MLGSCFGCG 345
MLGS FGCG
Sbjct: 96 MLGSLFGCG 104
>AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength
rhodopsin protein.
Length = 154
Score = 22.2 bits (45), Expect = 3.3
Identities = 8/9 (88%), Positives = 8/9 (88%)
Frame = +1
Query: 319 MLGSCFGCG 345
MLGS FGCG
Sbjct: 6 MLGSLFGCG 14
>AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic
acetylcholine receptorApisa2 subunit protein.
Length = 541
Score = 20.6 bits (41), Expect = 10.0
Identities = 9/40 (22%), Positives = 15/40 (37%)
Frame = -3
Query: 158 KVAFVTLPKTMTFKYPDLFEKSINEEEXHAKSLDESKKNF 39
K+ LPK + + PD + + H + K F
Sbjct: 338 KIFIRRLPKLLLMRVPDDLLNDLAAHKMHGRGRSGKKSKF 377
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,812
Number of Sequences: 438
Number of extensions: 2365
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14354847
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -