Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P07_F_L17
         (483 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein pr...    22   3.4  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    21   4.5  

>AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein
           protein.
          Length = 392

 Score = 21.8 bits (44), Expect = 3.4
 Identities = 13/52 (25%), Positives = 22/52 (42%), Gaps = 6/52 (11%)
 Frame = +2

Query: 128 WSTITTLSTTPSYSAKGL------RTFITFYPRCHPPLASPFRAFWPMIRLT 265
           WS      +TP+Y  +GL       T  +F     PP  +P  A +  + ++
Sbjct: 178 WSATPQAGSTPTYQTQGLLSPSYGGTTYSFTADFRPPQETPVLASYKSVPMS 229


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 130 VYHHNAKYDSK 162
           +Y+H A YDSK
Sbjct: 166 LYNHTANYDSK 176


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,082
Number of Sequences: 336
Number of extensions: 1912
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 11352204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)