Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P07_F_J16
         (811 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    23   4.4  

>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 22.6 bits (46), Expect = 4.4
 Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
 Frame = +3

Query: 402 SKTEINILCFDITNYSQLTQFLCCSIFVF----IFYLAYGYFLELIFAKPEVKPVSLYIT 569
           + TE+N   F +   +  T   C  + +       Y+    F +L+F+K + K  + +IT
Sbjct: 326 TNTELNPNTFILVAENNTTMVFCNDLSIDRSTNTMYVLSDNFQQLLFSKYDAKKRNFFIT 385

Query: 570 L 572
           +
Sbjct: 386 M 386


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,312
Number of Sequences: 438
Number of extensions: 4269
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25731924
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)