BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P07_F_E09
(528 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 25 0.36
AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 1.9
AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 4.5
>AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family
protein protein.
Length = 166
Score = 25.4 bits (53), Expect = 0.36
Identities = 13/32 (40%), Positives = 19/32 (59%)
Frame = -2
Query: 101 IHLAKLD*YHLPQQQIILKKLIRSNQLNVSSA 6
I+ +D H P +L+ LIRS QLN+ S+
Sbjct: 45 INSRNMDIEHDPGLAAVLQYLIRSGQLNIISS 76
>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
receptor protein.
Length = 1040
Score = 23.0 bits (47), Expect = 1.9
Identities = 7/13 (53%), Positives = 10/13 (76%)
Frame = -2
Query: 212 ITPYKTNYTEQCN 174
+TPY NYT+ C+
Sbjct: 443 VTPYNKNYTKFCS 455
>AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera
ORF for hypotheticalprotein. ).
Length = 998
Score = 21.8 bits (44), Expect = 4.5
Identities = 8/13 (61%), Positives = 12/13 (92%)
Frame = +3
Query: 108 TSIPTHIDYVGQA 146
TS+PT+I Y+G+A
Sbjct: 652 TSMPTYICYLGKA 664
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,816
Number of Sequences: 438
Number of extensions: 2410
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14845611
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -