SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P07_F_E09
         (528 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF134820-1|AAD40235.1|  166|Apis mellifera putative Ets-family p...    25   0.36 
AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    23   1.9  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    22   4.5  

>AF134820-1|AAD40235.1|  166|Apis mellifera putative Ets-family
           protein protein.
          Length = 166

 Score = 25.4 bits (53), Expect = 0.36
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -2

Query: 101 IHLAKLD*YHLPQQQIILKKLIRSNQLNVSSA 6
           I+   +D  H P    +L+ LIRS QLN+ S+
Sbjct: 45  INSRNMDIEHDPGLAAVLQYLIRSGQLNIISS 76


>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 212 ITPYKTNYTEQCN 174
           +TPY  NYT+ C+
Sbjct: 443 VTPYNKNYTKFCS 455


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 8/13 (61%), Positives = 12/13 (92%)
 Frame = +3

Query: 108 TSIPTHIDYVGQA 146
           TS+PT+I Y+G+A
Sbjct: 652 TSMPTYICYLGKA 664


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,816
Number of Sequences: 438
Number of extensions: 2410
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14845611
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -