BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P07_F_A13
(871 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB065602-1|BAC05830.1| 268|Homo sapiens seven transmembrane hel... 30 9.5
>AB065602-1|BAC05830.1| 268|Homo sapiens seven transmembrane helix
receptor protein.
Length = 268
Score = 30.3 bits (65), Expect = 9.5
Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
Frame = -2
Query: 537 IVQNLFTVHLII--CHSLSAVQYDLALSILGHVQPHASDRIQYCSHTPVFYGINGFRGLT 364
+ Q F + L+I CH L+A+ YD ++I + H + Q CS V GF G T
Sbjct: 98 MTQLYFFLVLVISECHMLAAMAYDHYIAICNPLLYHVAMSYQVCSWMVVEVYFMGFIGAT 157
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,724,414
Number of Sequences: 237096
Number of extensions: 2373288
Number of successful extensions: 5215
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5120
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5215
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11048563978
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -