BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P06_pT_M07
(855 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014134-2678|AAF53505.2| 2190|Drosophila melanogaster CG12455-P... 29 8.1
>AE014134-2678|AAF53505.2| 2190|Drosophila melanogaster CG12455-PA,
isoform A protein.
Length = 2190
Score = 29.1 bits (62), Expect = 8.1
Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 5/45 (11%)
Frame = +2
Query: 266 SNQHFSSLK*TKSFYLTDSKFGG-----NSSLRQTNIFLNLLKTL 385
S+Q +S+ T +FYLT S FG + ++ + NI NL+K L
Sbjct: 1412 SSQQTTSIYATTTFYLTSSTFGSTHPIVDENINRVNIMGNLIKGL 1456
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,910,483
Number of Sequences: 53049
Number of extensions: 602072
Number of successful extensions: 1164
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1164
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4106450400
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -