SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P06_pT_C04
         (565 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY280612-1|AAQ21365.1|  309|Anopheles gambiae carbonic anhydrase...    25   1.7  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           24   3.9  

>AY280612-1|AAQ21365.1|  309|Anopheles gambiae carbonic anhydrase
           protein.
          Length = 309

 Score = 25.0 bits (52), Expect = 1.7
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = +1

Query: 157 MSHFICMLCTLLFIVFHCRSSAYEYPMLST 246
           M  F  +LC  LF++   R   + YP   T
Sbjct: 1   MKSFTLLLCYALFVLHAARGDEWNYPTPGT 30


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.8 bits (49), Expect = 3.9
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = -3

Query: 479 SFSCYCWSLCGCC 441
           S++ +C++LC CC
Sbjct: 771 SYNTHCFALCHCC 783


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 566,428
Number of Sequences: 2352
Number of extensions: 10717
Number of successful extensions: 20
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 52983882
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -