BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P06_pT_C01
(645 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 25 2.7
EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 6.3
>EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein.
Length = 399
Score = 24.6 bits (51), Expect = 2.7
Identities = 11/31 (35%), Positives = 17/31 (54%)
Frame = -3
Query: 628 QVKDIIENKKIDVNASIDGRVPLHYAADYGQ 536
+++D + IDVNA + LH AD+ Q
Sbjct: 175 RIRDYLAESDIDVNAELMLLNALHMRADWAQ 205
>EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium
channel beta subunitprotein.
Length = 466
Score = 23.4 bits (48), Expect = 6.3
Identities = 9/13 (69%), Positives = 11/13 (84%)
Frame = -3
Query: 406 GASKNGKTPDGTP 368
GAS++GKTP TP
Sbjct: 203 GASRHGKTPLATP 215
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 606,321
Number of Sequences: 2352
Number of extensions: 11491
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63559560
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -