Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P06_pT_A01
         (757 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK091298-1|BAC03631.1|  273|Homo sapiens protein ( Homo sapiens ...    57   6e-08

>AK091298-1|BAC03631.1|  273|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33979 fis, clone DFNES2004371. ).
          Length = 273

 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/70 (45%), Positives = 42/70 (60%)
 Frame = -1

Query: 754 GYLDMRMDAGRDPNQISAREVLATASXQELYKIFKIYGEEKKAAKIAQTILQARYMIKNI 575
           G LD+RMD GR P+  +A +V+     Q L  I + YGEEK A KIA  I+QAR  I  I
Sbjct: 190 GPLDVRMDGGRYPDMPTAADVVNALDQQALASILRTYGEEKHAKKIASAIVQAR-SIYPI 248

Query: 574 ETTEELVDLV 545
             T++L  +V
Sbjct: 249 TRTQQLASIV 258


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,747,427
Number of Sequences: 237096
Number of extensions: 1720171
Number of successful extensions: 3556
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3471
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3556
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 9127122082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)