BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P06_F_O01
(474 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014298-2084|AAF48409.1| 296|Drosophila melanogaster CG9030-PA... 27 9.8
>AE014298-2084|AAF48409.1| 296|Drosophila melanogaster CG9030-PA
protein.
Length = 296
Score = 27.5 bits (58), Expect = 9.8
Identities = 13/48 (27%), Positives = 23/48 (47%)
Frame = +3
Query: 135 ISFIHSCLQLFDSVYKSLRIFTTKRKKKMKHDVYKSLCLTLCNSCLRM 278
I H+CL+ ++K + + R +K+K+ YK L C+ M
Sbjct: 69 IGSTHNCLEFISILFKKAHLKKSHRLRKVKNFKYKQLRRFRIIGCILM 116
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,011,145
Number of Sequences: 53049
Number of extensions: 234228
Number of successful extensions: 578
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 542
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 578
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1622204766
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -