SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P06_F_C04
         (578 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    25   0.71 
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    23   1.6  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    23   2.9  
DQ435335-1|ABD92650.1|  135|Apis mellifera OBP18 protein.              21   8.8  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 24.6 bits (51), Expect = 0.71
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +1

Query: 250 HLSYL*VSFVQSRAFK*LEWLTALDIRTQTI 342
           +LSY  ++ + +R FK L +L  LD+R  +I
Sbjct: 341 NLSYNMLTHIDARMFKDLFFLQILDLRNNSI 371



 Score = 22.2 bits (45), Expect = 3.8
 Identities = 5/12 (41%), Positives = 9/12 (75%)
 Frame = +3

Query: 78  FSCYCWSLCGCC 113
           +  +C++LC CC
Sbjct: 739 YEAHCFALCHCC 750


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 9/31 (29%), Positives = 16/31 (51%)
 Frame = -1

Query: 425 FNWNAQHVNYVTFYLHVVYIAVYCFSLPIVC 333
           +N+N  + NY   Y +++ I      +PI C
Sbjct: 322 YNYNNYNNNYKPLYYNIINIEQIPVPVPIYC 352


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 5/11 (45%), Positives = 8/11 (72%)
 Frame = -3

Query: 393 HILFACCVHCC 361
           H++ +CC  CC
Sbjct: 6   HVVMSCCCWCC 16


>DQ435335-1|ABD92650.1|  135|Apis mellifera OBP18 protein.
          Length = 135

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 303 KLFKCSGLYKT 271
           KL KC G YKT
Sbjct: 118 KLLKCIGKYKT 128


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,742
Number of Sequences: 438
Number of extensions: 3018
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16748661
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -