Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P06_F_B19
         (781 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   5.6  
DQ435331-1|ABD92646.1|  135|Apis mellifera OBP14 protein.              21   9.7  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    21   9.7  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   9.7  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   9.7  

>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 12/34 (35%), Positives = 15/34 (44%)
 Frame = +1

Query: 652 KDPKNPTLRTNFFNGVISASRLAKMTPEEMASDE 753
           K PKN T   NF  G I  +   K   ++   DE
Sbjct: 59  KGPKNYTTPVNFVAGGIQQAGKPKEETDDKDDDE 92


>DQ435331-1|ABD92646.1|  135|Apis mellifera OBP14 protein.
          Length = 135

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 7/17 (41%), Positives = 13/17 (76%)
 Frame = +2

Query: 590 LNSKTLTCVTKTGLDQE 640
           L+++   C T+TG+DQ+
Sbjct: 26  LHTEQSVCKTETGIDQQ 42


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = +2

Query: 431 NCQHHFHHSPTL 466
           N  HH+HH P +
Sbjct: 468 NTLHHWHHCPEI 479


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 5/6 (83%), Positives = 5/6 (83%)
 Frame = -2

Query: 453 WWK*CW 436
           WWK CW
Sbjct: 490 WWKICW 495


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 5/6 (83%), Positives = 5/6 (83%)
 Frame = -2

Query: 453 WWK*CW 436
           WWK CW
Sbjct: 543 WWKICW 548


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,334
Number of Sequences: 438
Number of extensions: 2376
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24518154
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)