BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P05_pT_K08
(304 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
10_06_0153 + 11285685-11285716,11288322-11288974,11289541-11289647 26 6.5
>10_06_0153 + 11285685-11285716,11288322-11288974,11289541-11289647
Length = 263
Score = 25.8 bits (54), Expect = 6.5
Identities = 13/41 (31%), Positives = 20/41 (48%)
Frame = -3
Query: 173 SSLSNLIPSPMMYNHYNVSKVSPLQSKLHFYFEEK*SNXLC 51
S+ S ++ + Y HYN + SP S F+F E + C
Sbjct: 174 SAKSTIVEMELSYCHYNFTAYSP-SSGFGFFFAETSDDVKC 213
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,727,814
Number of Sequences: 37544
Number of extensions: 110960
Number of successful extensions: 174
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 173
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 174
length of database: 14,793,348
effective HSP length: 71
effective length of database: 12,127,724
effective search space used: 351703996
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -