SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P05_pT_K08
         (304 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_06_0153 + 11285685-11285716,11288322-11288974,11289541-11289647     26   6.5  

>10_06_0153 + 11285685-11285716,11288322-11288974,11289541-11289647
          Length = 263

 Score = 25.8 bits (54), Expect = 6.5
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = -3

Query: 173 SSLSNLIPSPMMYNHYNVSKVSPLQSKLHFYFEEK*SNXLC 51
           S+ S ++   + Y HYN +  SP  S   F+F E   +  C
Sbjct: 174 SAKSTIVEMELSYCHYNFTAYSP-SSGFGFFFAETSDDVKC 213


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,727,814
Number of Sequences: 37544
Number of extensions: 110960
Number of successful extensions: 174
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 173
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 174
length of database: 14,793,348
effective HSP length: 71
effective length of database: 12,127,724
effective search space used: 351703996
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -