Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P05_pT_K07
         (542 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-1685|ABC66175.1|   94|Drosophila melanogaster CG33977-P...    60   3e-09

>AE014297-1685|ABC66175.1|   94|Drosophila melanogaster CG33977-PA
           protein.
          Length = 94

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = -3

Query: 318 MTKLMEWISLCSAFFAVWYSLIGGYVKHPLIQENMHQIVLSPIYFLILFGLYSVSVILFR 139
           MT L  W+   S F   + S++ G V+ PL  +    I L P+  L++FG+YSV  +L+R
Sbjct: 1   MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLHIQLLPLLLLVIFGIYSVWTVLYR 60

Query: 138 VLTFNNC 118
            LTFN+C
Sbjct: 61  TLTFNDC 67


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,843,683
Number of Sequences: 53049
Number of extensions: 336427
Number of successful extensions: 590
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 572
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 590
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 2074444800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)