BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P05_pT_G13
(614 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
02_01_0777 - 5785295-5787370,5787723-5788769 27 8.9
>02_01_0777 - 5785295-5787370,5787723-5788769
Length = 1040
Score = 27.5 bits (58), Expect = 8.9
Identities = 8/33 (24%), Positives = 19/33 (57%)
Frame = -3
Query: 372 IIIHKYLHKITDKNVTIVFTVVPIVRNCNEKKI 274
+I+HK LH+ N+ + ++P+ N+ ++
Sbjct: 787 LILHKILHRDNKDNIEAIQGLLPLAERANDSRV 819
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,079,350
Number of Sequences: 37544
Number of extensions: 257702
Number of successful extensions: 394
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 391
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 394
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1478421500
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -