BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P05_pT_A23
(488 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 29 0.020
DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.3
>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
protein.
Length = 1010
Score = 29.5 bits (63), Expect = 0.020
Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
Frame = +3
Query: 21 YKIKYRNTTVSEIQMRSQPI*LRVTI-KNNIQNLQIKTLYIALLSHNDNNL 170
Y+I ++ S + +Q I ++ T KNN QN+ I Y ALLSH++ L
Sbjct: 159 YEILPQHHLDSRVIQEAQNIAIQNTQGKNNQQNILIPVNYSALLSHDEQQL 209
>DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine
receptor beta1subunit protein.
Length = 520
Score = 20.6 bits (41), Expect = 9.3
Identities = 8/13 (61%), Positives = 12/13 (92%)
Frame = -1
Query: 461 IVFTFIISDVSIL 423
++FTFI++ VSIL
Sbjct: 300 LLFTFIMNTVSIL 312
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,152
Number of Sequences: 438
Number of extensions: 1984
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13421061
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -