SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P05_pT_A23
         (488 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    29   0.020
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    21   9.3  

>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 29.5 bits (63), Expect = 0.020
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +3

Query: 21  YKIKYRNTTVSEIQMRSQPI*LRVTI-KNNIQNLQIKTLYIALLSHNDNNL 170
           Y+I  ++   S +   +Q I ++ T  KNN QN+ I   Y ALLSH++  L
Sbjct: 159 YEILPQHHLDSRVIQEAQNIAIQNTQGKNNQQNILIPVNYSALLSHDEQQL 209


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 20.6 bits (41), Expect = 9.3
 Identities = 8/13 (61%), Positives = 12/13 (92%)
 Frame = -1

Query: 461 IVFTFIISDVSIL 423
           ++FTFI++ VSIL
Sbjct: 300 LLFTFIMNTVSIL 312


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,152
Number of Sequences: 438
Number of extensions: 1984
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13421061
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -