BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P05_F_C15
(375 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK127397-1|BAC86958.1| 130|Homo sapiens protein ( Homo sapiens ... 28 8.6
>AK127397-1|BAC86958.1| 130|Homo sapiens protein ( Homo sapiens
cDNA FLJ45488 fis, clone BRTHA2003759. ).
Length = 130
Score = 28.3 bits (60), Expect = 8.6
Identities = 9/36 (25%), Positives = 23/36 (63%)
Frame = +3
Query: 3 LVLYNFLPLTVHTKVRLNILVKHTLCVFLNYYLFIY 110
L ++ ++ + +H + L+I + +C+++ Y+FIY
Sbjct: 65 LYIFTYIYIYLHIFIYLHIFIYICICLYIFIYVFIY 100
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,260,390
Number of Sequences: 237096
Number of extensions: 445940
Number of successful extensions: 414
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 413
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 414
length of database: 76,859,062
effective HSP length: 81
effective length of database: 57,654,286
effective search space used: 2479134298
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -