Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P04_pT_B24
         (751 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_01_0573 - 5083030-5083151,5084639-5084738,5084790-5084829,508...    29   5.2  

>05_01_0573 -
           5083030-5083151,5084639-5084738,5084790-5084829,
           5085122-5085567
          Length = 235

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 17/67 (25%), Positives = 29/67 (43%)
 Frame = +3

Query: 333 PTHA*SHPLGLPVNKDRKKCYAVKLAEQKRQWKQNWPIVSNTRRAHCGLGECVITINSYK 512
           P+ +  + LG+P+   R  C A     ++R W+   P  +N  R    LG  ++    Y 
Sbjct: 105 PSSSSQYLLGIPIAASR--CMATNEEARRRWWRGRQPAGANRSRIRRALGASLLARRVYF 162

Query: 513 NSLHLCN 533
             L + N
Sbjct: 163 IGLFVTN 169


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,667,932
Number of Sequences: 37544
Number of extensions: 335145
Number of successful extensions: 636
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 624
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 636
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1992480932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)