BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P04_F_K05
(753 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
09_02_0395 - 8536630-8537678,8537716-8537783,8538110-8538204 30 2.3
>09_02_0395 - 8536630-8537678,8537716-8537783,8538110-8538204
Length = 403
Score = 29.9 bits (64), Expect = 2.3
Identities = 10/37 (27%), Positives = 21/37 (56%)
Frame = +3
Query: 174 TTPTGAILPEPQKQPFGLLCVVFAVVPGLLIGAAISK 284
T ++ + PFGL+C++F + G+L +++K
Sbjct: 326 TVAINVLIWDKHSSPFGLICLLFTIAGGVLYQQSVTK 362
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,798,610
Number of Sequences: 37544
Number of extensions: 276878
Number of successful extensions: 580
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 573
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 580
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2004270760
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -