Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P04_F_E20
         (834 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    26   1.6  
AY193728-1|AAO62001.1|  519|Anopheles gambiae cytochrome P450 CY...    23   8.7  

>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
            growth factor receptorprotein.
          Length = 1433

 Score = 25.8 bits (54), Expect = 1.6
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = +3

Query: 171  SAEGKTPEYMALAGIKFKLSLPEFKDNIQLKEQLLNGIKAGHMAPY 308
            S    TP YM L G+   +  PE+   +    Q + G+  G M P+
Sbjct: 1227 SQNQSTPGYMDLIGVPASVDNPEY---LMGSTQAIAGLAQGSMGPH 1269


>AY193728-1|AAO62001.1|  519|Anopheles gambiae cytochrome P450
           CYPm3r5 protein.
          Length = 519

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +3

Query: 582 NVKEMGKAINKAH 620
           N KEMGK+I+ AH
Sbjct: 49  NFKEMGKSIHPAH 61


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 792,075
Number of Sequences: 2352
Number of extensions: 15814
Number of successful extensions: 16
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 88065063
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)