Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P04_F_B21
         (849 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK127176-1|BAC86869.1|  791|Homo sapiens protein ( Homo sapiens ...    34   0.57 

>AK127176-1|BAC86869.1|  791|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45241 fis, clone BRCOC2006164. ).
          Length = 791

 Score = 34.3 bits (75), Expect = 0.57
 Identities = 16/64 (25%), Positives = 30/64 (46%)
 Frame = +3

Query: 252 INKNLITLKCVLFCFLSGVGCIFPFLPLHMLSVGLDKGEARLISAVSPCIALLGPAIVGP 431
           IN +L+  K   F F S  G ++P LP++   +G+   ++ L+  +   I        G 
Sbjct: 64  INNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGV 123

Query: 432 LIDK 443
           + D+
Sbjct: 124 VADR 127


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,688,485
Number of Sequences: 237096
Number of extensions: 2477085
Number of successful extensions: 4576
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4568
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10761200974
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)