BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P03_pT_N17
(759 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 9.5
AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 9.5
>AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier
protein JHBP-1 protein.
Length = 253
Score = 21.4 bits (43), Expect = 9.5
Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
Frame = -1
Query: 486 DLKNPCDIHD-SLNCSFYHHCLR*NIRTSVLWCGGGEIGFISLPV 355
+L N I D SL Y+ C+ +R +V+ GG F LP+
Sbjct: 23 ELPNNWRICDRSLPQKEYNQCIAEAVRDAVVSLAGGLKSFKILPI 67
>AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic
acetylcholine Apisa7-2 subunit protein.
Length = 461
Score = 21.4 bits (43), Expect = 9.5
Identities = 6/9 (66%), Positives = 8/9 (88%)
Frame = +2
Query: 461 WISHGFFKS 487
W+SHG F+S
Sbjct: 121 WLSHGIFRS 129
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,971
Number of Sequences: 438
Number of extensions: 4233
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23875740
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -