SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P03_pT_J20
         (535 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    21   6.0  
DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GP...    21   7.9  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 14/55 (25%), Positives = 23/55 (41%)
 Frame = +3

Query: 219 FNSA*LVKFNSSDVILNKFSFRVDKCSLFKHAIDKSLECLQSFLVGLLVTRSCTL 383
           F +A  V F +  +  +      DK  L+   +   L C  +FL+    T+ C L
Sbjct: 125 FKNAKSVTFQTMTIPNHYLWLYKDKTILYMVKLTLKLSCAMNFLIYPHDTQECKL 179


>DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GPCR
           protein.
          Length = 381

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +3

Query: 69  SHDKKRNVSIKC 104
           S DK+RN S KC
Sbjct: 367 SSDKERNSSFKC 378


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,544
Number of Sequences: 438
Number of extensions: 2671
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15090993
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -