Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P03_pT_C15
         (736 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1306 + 29208882-29209547,29209641-29209854,29209947-292100...    30   2.2  

>06_03_1306 + 29208882-29209547,29209641-29209854,29209947-29210023,
            29210132-29210171,29210254-29210323,29210419-29210488,
            29210747-29210995,29212810-29214700,29215458-29215771
          Length = 1196

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +1

Query: 49   KIHSMSNTLFLST-LTLGALFSFFINLSAILSSISWPVASLYSANTF 186
            +I S SN  F++  +TLG L S  INL  + SS  W  + L S ++F
Sbjct: 892  EILSSSNLKFVAMFITLGKLVSERINLVEMFSSPEWASSDLASRSSF 938


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,545,399
Number of Sequences: 37544
Number of extensions: 184037
Number of successful extensions: 465
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 456
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 465
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1933531792
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)