SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P03_F_N14
         (699 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    23   2.1  
DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated...    21   8.5  

>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -1

Query: 306 YRCELCSKAFD 274
           Y+C LC KAFD
Sbjct: 62  YQCLLCQKAFD 72



 Score = 22.6 bits (46), Expect = 3.7
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -1

Query: 306 YRCELCSKAF 277
           Y+CE CSK+F
Sbjct: 120 YQCEYCSKSF 129



 Score = 21.8 bits (44), Expect = 6.4
 Identities = 5/11 (45%), Positives = 10/11 (90%)
 Frame = -1

Query: 306 YRCELCSKAFD 274
           Y+C++C +AF+
Sbjct: 148 YKCDVCERAFE 158



 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -1

Query: 306 YRCELCSKAF 277
           YRC +C K F
Sbjct: 92  YRCNICGKTF 101


>DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 391

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -1

Query: 483 ATIVPTPLTRLTLFF*KSIAIPPVRPLTALALY 385
           A +V + LT +T+F      IPPV  + AL ++
Sbjct: 233 ALLVTSMLTLVTMFTGLKSDIPPVAYVKALDVW 265


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 192,171
Number of Sequences: 438
Number of extensions: 4650
Number of successful extensions: 11
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -